Rv3418c - 10 kda chaperonin groES

Expression: Most Significant Conditions for Rv3418c

Protein Domains

Gene Information
Locus	Rv3418c
Symbol	groES
Gene Name	10 kda chaperonin groES
Location	3836986 - 3837288 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:303 bp Protein:101 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	245
Related Genes	Acel_0362 BL1558 CE0601 cg0690 DIP0575 jk1729 MAP4264 MAV_4366 Mkms_1170 ML0380 Mmcs_1153 MSMEG_1582 MT3527 MUL_0885 Mvan_1494 nfa8860 PPA1773 SAV4991 SCO4761
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3418c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3418c Transcript 1
MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIP
LDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK*

Genomic Sequence

>Rv3418c
GTGGCGAAGGTGAACATCAAGCCACTCGAGGACAAGATTCTCGTGCAGGCCAACGAGGCC
GAGACCACGACCGCGTCCGGTCTGGTCATTCCTGACACCGCCAAGGAGAAGCCGCAGGAG
GGCACCGTCGTTGCCGTCGGCCCTGGCCGGTGGGACGAGGACGGCGAGAAGCGGATCCCG
CTGGACGTTGCGGAGGGTGACACCGTCATCTACAGCAAGTACGGCGGCACCGAGATCAAG
TACAACGGCGAGGAATACCTGATCCTGTCGGCACGCGACGTGCTGGCCGTCGTTTCCAAG
TAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3417c	active	chirupolo	2012-10-05
	Structural analysis V. Aravindhan, AJ. Christy et al. Mycobacterium tuberculosis groE promoter controls the expression of the bicistronic groESL1 operon and shows differential regulation under stress conditions. FEMS Microbiol. Lett. 2009
Interaction	PhysicalInteraction Rv3417c	active	chirupolo	2012-10-05
	Structural analysis MM. Roberts, AR. Coker et al. Mycobacterium tuberculosis chaperonin 10 heptamers self-associate through their biologically active loops. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv0440	active	priti.priety	2012-10-05
	Structural Analysis authors,R. Qamra,SC. Mande Crystal structure of the 65-kilodalton heat shock protein, chaperonin 60.2, of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	PhysicalInteraction Rv0440	active	priti.priety	2012-10-05
	Structural Analysis authors,S. Sinha,S. Arora,K. Kosalai,A. Namane,AS. Pym,ST. Cole Proteome analysis of the plasma membrane of Mycobacterium tuberculosis. Comp. Funct. Genomics 2002
Interaction	PhysicalInteraction Rv0440	active	priti.priety	2012-10-05
	Spectrophotometric authors,R. Qamra,SC. Mande Crystal structure of the 65-kilodalton heat shock protein, chaperonin 60.2, of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	PhysicalInteraction Rv0440	active	priti.priety	2012-10-05
	Spectrophotometric authors,S. Sinha,S. Arora,K. Kosalai,A. Namane,AS. Pym,ST. Cole Proteome analysis of the plasma membrane of Mycobacterium tuberculosis. Comp. Funct. Genomics 2002
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Interaction	RegulatedBy Rv3678c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3414c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2745c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2021c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2374c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008