Rv1986 - conserved membrane protein

Expression: Most Significant Conditions for Rv1986

Protein Domains

Gene Information
Locus	Rv1986
Symbol
Gene Name	conserved membrane protein
Location	2230011 - 2230610 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:600 bp Protein:200 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18987
Related Genes	CE1357 cg1424 DIP1091 Mkms_0282 Mmcs_0272 MSMEG_0467 MT2040 Mvan_0310 nfa1450 SAV1120
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1986
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1986 Transcript 1
MNSPLVVGFLACFTLIAAIGAQNAFVLRQGIQREHVLPVVALCTVSDIVLIAAGIAGFGA
LIGAHPRALNVVKFGGAAFLIGYGLLAARRAWRPVALIPSGATPVRLAEVLVTCAAFTFL
NPHVYLDTVVLLGALANEHSDQRWLFGLGAVTASAVWFATLGFGAGRLRGLFTNPGSWRI
LDGLIAVMMVALGISLTVT*

Genomic Sequence

>Rv1986
GTGAACTCACCACTGGTCGTCGGCTTCCTGGCCTGCTTCACGCTGATCGCCGCGATTGGC
GCGCAGAACGCATTCGTGCTGCGGCAGGGAATCCAGCGTGAGCACGTGCTGCCGGTGGTG
GCGCTGTGCACGGTGTCCGACATCGTGCTGATCGCCGCCGGTATCGCGGGGTTCGGCGCA
TTGATCGGCGCACATCCGCGTGCGCTCAATGTCGTCAAGTTTGGCGGCGCCGCCTTCCTA
ATCGGCTACGGGCTACTTGCGGCCCGGCGGGCGTGGCGACCTGTTGCGCTGATCCCATCT
GGCGCCACGCCGGTTCGCTTAGCCGAGGTCCTGGTGACCTGTGCGGCATTCACGTTCCTC
AACCCACACGTCTACCTCGACACCGTCGTGTTGCTAGGCGCGCTGGCCAACGAGCACAGC
GACCAGCGCTGGCTGTTCGGCCTCGGCGCGGTCACAGCCAGTGCGGTATGGTTCGCCACC
CTCGGGTTCGGAGCCGGCCGGTTGCGCGGGCTGTTCACCAACCCCGGCTCGTGGAGAATC
CTCGACGGCCTGATCGCGGTCATGATGGTTGCGCTGGGAATCTCGCTGACCGTGACCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006