Rv2031c - heat shock protein hspX

Expression: Most Significant Conditions for Rv2031c

Protein Domains

Gene Information
Locus	Rv2031c
Symbol	hspX
Gene Name	heat shock protein hspX
Location	2278498 - 2278932 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:435 bp Protein:145 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29267
Related Genes	Acel_0160 Mkms_1098 MSMEG_3932 MT2090 Mvan_1374 nfa8400 PPA0737
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2031c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2031c Transcript 1
MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGV
DPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKG
ILTVSVAVSEGKPTEKHIQIRSTN*

Genomic Sequence

>Rv2031c
ATGGCCACCACCCTTCCCGTTCAGCGCCACCCGCGGTCCCTCTTCCCCGAGTTTTCTGAG
CTGTTCGCGGCCTTCCCGTCATTCGCCGGACTCCGGCCCACCTTCGACACCCGGTTGATG
CGGCTGGAAGACGAGATGAAAGAGGGGCGCTACGAGGTACGCGCGGAGCTTCCCGGGGTC
GACCCCGACAAGGACGTCGACATTATGGTCCGCGATGGTCAGCTGACCATCAAGGCCGAG
CGCACCGAGCAGAAGGACTTCGACGGTCGCTCGGAATTCGCGTACGGTTCCTTCGTTCGC
ACGGTGTCGCTGCCGGTAGGTGCTGACGAGGACGACATTAAGGCCACCTACGACAAGGGC
ATTCTTACTGTGTCGGTGGCGGTTTCGGAAGGGAAGCCAACCGAAAAGCACATTCAGATC
CGGTCCACCAACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2069	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv2069	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv2034	active	priti.priety	2012-10-05
	Bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2032	active	priti.priety	2012-10-05
	Spectrophotometric analysis A. Purkayastha, LA. McCue et al. Identification of a Mycobacterium tuberculosis putative classical nitroreductase gene whose expression is coregulated with that of the acr aene within macrophages, in standing versus shaking cultures, and under low oxygen conditions. Infect. Immun. 2002
Interaction	Signaling Rv3133c	active	priti.priety	2012-10-05
	affinity purification A. Demissie, EM. Leyten et al. Recognition of stage-specific mycobacterial antigens differentiates between acute and latent infections with Mycobacterium tuberculosis. Clin. Vaccine Immunol. 2006
Interaction	Signaling Rv3133c	active	priti.priety	2012-10-05
	affinity purification M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2007c	active	prabhakarsmail	2012-10-05
	co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv2007c	active	akankshajain.21	2012-10-05
	co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv1997	active	jgalag	2012-10-05
	authors,H. Ohno,G. Zhu,VP. Mohan,D. Chu,S. Kohno,WR. Jacobs,J. Chan The effects of reactive nitrogen intermediates on gene expression in Mycobacterium tuberculosis. Cell. Microbiol. 2003
Interaction	Regulatory Rv1997	active	jgalag	2012-10-05
	D. Agranoff & S. Krishna Metal ion transport and regulation in Mycobacterium tuberculosis. Front. Biosci. 2004
Interaction	Regulatory Rv1997	active	jgalag	2012-10-05
	MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv1996	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) authors,SM. Hingley-Wilson,KE. Lougheed,K. Ferguson,S. Leiva,HD. Williams Individual Mycobacterium tuberculosis universal stress protein homologues are dispensable in vitro. Tuberculosis (Edinb) 2010
Interaction	Regulatory Rv1996	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Structural Analysis J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Spectrophotometric J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3681c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3678c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2034	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2069	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008