Rv0129c - secreted fibronectin-binding protein C antigen 85-C fbpC

Expression: Most Significant Conditions for Rv0129c

Protein Domains

Gene Information
Locus	Rv0129c
Symbol	fbpC
Gene Name	secreted fibronectin-binding protein C antigen 85-C fbpC
Location	156578 - 157600 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1023 bp Protein:341 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22427
Related Genes	MAP3531c MAV_5183 ML2655 MT0137 MUL_4793
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0129c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0129c Transcript 1
MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVP
SASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQS
SFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILA
AYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQ
IPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA*

Genomic Sequence

>Rv0129c
ATGACGTTCTTCGAACAGGTGCGAAGGTTGCGGAGCGCAGCGACAACCCTGCCGCGCCGG
CTGGCTATCGCGGCTATGGGGGCTGTCCTGGTTTACGGTCTGGTCGGTACCTTCGGCGGG
CCGGCCACCGCGGGCGCATTCTCTAGGCCCGGTCTTCCAGTGGAATATCTGCAGGTGCCA
TCCGCGTCGATGGGCCGCGACATCAAGGTCCAGTTCCAGGGCGGCGGACCGCACGCGGTC
TACCTGCTCGACGGTCTGCGGGCCCAGGATGACTACAACGGCTGGGACATCAACACCCCG
GCCTTCGAGGAGTACTACCAGTCAGGGTTGTCGGTGATCATGCCCGTGGGCGGCCAATCC
AGTTTCTACACCGACTGGTATCAGCCCTCGCAGAGCAACGGCCAGAACTACACCTACAAG
TGGGAGACCTTCCTTACCAGAGAGATGCCCGCCTGGCTACAGGCCAACAAGGGCGTGTCC
CCGACAGGCAACGCGGCGGTGGGTCTTTCGATGTCGGGCGGTTCCGCGCTGATCCTGGCC
GCGTACTACCCGCAGCAGTTCCCGTACGCCGCGTCGTTGTCGGGCTTCCTCAACCCGTCC
GAGGGCTGGTGGCCGACGCTGATCGGCCTGGCGATGAACGACTCGGGCGGTTACAACGCC
AACAGCATGTGGGGTCCGTCCAGCGACCCGGCCTGGAAGCGCAACGACCCAATGGTTCAG
ATTCCCCGCCTGGTCGCCAACAACACCCGGATCTGGGTGTACTGCGGTAACGGCACACCC
AGCGACCTCGGCGGCGACAACATACCGGCGAAGTTCCTGGAAGGCCTCACCCTGCGCACC
AACCAGACCTTCCGGGACACCTACGCGGCCGACGGTGGACGCAACGGGGTGTTTAACTTC
CCGCCCAACGGAACACACTCGTGGCCCTACTGGAACGAGCAGCTGGTCGCCATGAAGGCC
GATATCCAGCATGTGCTCAACGGCGCGACACCCCCGGCCGCCCCTGCTGCGCCGGCCGCC
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2069	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv2069	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	structural analysis K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	structural analysis K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	structural analysis authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	structural analysis authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	structural analysis authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	structural analysis authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	structural analysis authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	structural analysis authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	structural analysis authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	structural analysis authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction	PhysicalInteraction Rv1886c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction	PhysicalInteraction Rv3804c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Name	mycolyltransferase 85C; INVOLVED IN CELL WALL MYCOLOYLATION	active	mjackson	2012-10-05
	Mycolic acid processing
Name	mycolyltransferase 85C; INVOLVED IN CELL WALL MYCOLOYLATION	active	mjackson	2012-10-05
	Mycolic acid processing
Symbol	Ag85C	active	jlew	2012-03-07
	Tat substrate. Demonstrated by experimental verification that four secreted proteins from Mtb carrying putative Tat signals are bona fide Tat substrates M. Marrichi, L. Camacho et al. Genetic Toggling of Alkaline Phosphatase Folding Reveals Signal Peptides for All Major Modes of Transport across the Inner Membrane of Bacteria. J. Biol. Chem. 2008
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
Term	EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	extern:JZUCKER	2012-03-06
	Reaction blocked in mutant authors,M. Jackson,C. Raynaud,MA. Lanéelle,C. Guilhot,C. Laurent-Winter,D. Ensergueix,B. Gicquel,M. Daffé Inactivation of the antigen 85C gene profoundly affects the mycolate content and alters the permeability of the Mycobacterium tuberculosis cell envelope. Mol. Microbiol. 1999
Term	EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Reaction blocked in mutant authors,M. Jackson,C. Raynaud,MA. Lanéelle,C. Guilhot,C. Laurent-Winter,D. Ensergueix,B. Gicquel,M. Daffé Inactivation of the antigen 85C gene profoundly affects the mycolate content and alters the permeability of the Mycobacterium tuberculosis cell envelope. Mol. Microbiol. 1999
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from experiment V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
Term	EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from experiment V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001