Rv3874 - 10 kda culture filtrate antigen esxB

Expression: Most Significant Conditions for Rv3874

Protein Domains

Gene Information
Locus	Rv3874
Symbol	esxB
Gene Name	10 kda culture filtrate antigen esxB
Location	4352274 - 4352576 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:303 bp Protein:101 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	13979
Related Genes	Mkms_0079 ML0050 Mmcs_0070 MSMEG_0065 MT3988 Mvan_0078
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3874
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3874 Transcript 1
MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQE
AANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF*

Genomic Sequence

>Rv3874
ATGGCAGAGATGAAGACCGATGCCGCTACCCTCGCGCAGGAGGCAGGTAATTTCGAGCGG
ATCTCCGGCGACCTGAAAACCCAGATCGACCAGGTGGAGTCGACGGCAGGTTCGTTGCAG
GGCCAGTGGCGCGGCGCGGCGGGGACGGCCGCCCAGGCCGCGGTGGTGCGCTTCCAAGAA
GCAGCCAATAAGCAGAAGCAGGAACTCGACGAGATCTCGACGAATATTCGTCAGGCCGGC
GTCCAATACTCGAGGGCCGACGAGGAGCAGCAGCAGGCGCTGTCCTCGCAAATGGGCTTC
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3876	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3876	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3875	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) ML. Burts, WA. Williams et al. EsxA and EsxB are secreted by an ESAT-6-like system that is required for the pathogenesis of Staphylococcus aureus infections. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3875	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) LM. Okkels & P. Andersen Protein-protein interactions of proteins from the ESAT-6 family of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	PhysicalInteraction Rv3875	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) ML. Burts, WA. Williams et al. EsxA and EsxB are secreted by an ESAT-6-like system that is required for the pathogenesis of Staphylococcus aureus infections. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3875	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) LM. Okkels & P. Andersen Protein-protein interactions of proteins from the ESAT-6 family of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3871	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3868	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3868	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3620c	active	ahal4789	2012-10-05
	Yeast two-hybrid (Physical interaction) G. Garufi, E. Butler et al. ESAT-6-like protein secretion in Bacillus anthracis. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3620c	active	sourish10	2012-10-05
	Yeast two-hybrid (Physical interaction) G. Garufi, E. Butler et al. ESAT-6-like protein secretion in Bacillus anthracis. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv1038c	active	raj252000	2012-10-05
	Structural analysis KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	Signaling Rv0686	active	sudhakar_dipu	2012-10-05
	Yeast two-hybrid (Physical interaction) A. Singh, D. Mai et al. Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	RegulatedBy Rv3414c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2021c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Symbol	CFP-10	active	jlew	2012-03-07
	Forms homodimer. Forms heterodimer with ESAT-6. Interacts with Rv3873.. Yeast two-hybrid to examine the interactions between ESX-1 proteins J. Teutschbein, G. Schumann et al. A protein linkage map of the ESAT-6 secretion system 1 (ESX-1) of Mycobacterium tuberculosis. Microbiol. Res. 2007