Rv3875 - 6 kda early secretory antigenic target esxA

Expression: Most Significant Conditions for Rv3875

Protein Domains

Gene Information
Locus	Rv3875
Symbol	esxA
Gene Name	6 kda early secretory antigenic target esxA
Location	4352609 - 4352896 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:288 bp Protein:96 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	13981
Related Genes	Mkms_0080 ML0049 Mmcs_0071 MSMEG_0066 MT3989 Mvan_0079
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3875
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3875 Transcript 1
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDA
TATELNNALQNLARTISEAGQAMASTEGNVTGMFA*

Genomic Sequence

>Rv3875
ATGACAGAGCAGCAGTGGAATTTCGCGGGTATCGAGGCCGCGGCAAGCGCAATCCAGGGA
AATGTCACGTCCATTCATTCCCTCCTTGACGAGGGGAAGCAGTCCCTGACCAAGCTCGCA
GCGGCCTGGGGCGGTAGCGGTTCGGAGGCGTACCAGGGTGTCCAGCAAAAATGGGACGCC
ACGGCTACCGAGCTGAACAACGCGCTGCAGAACCTGGCGCGGACGATCAGCGAAGCCGGT
CAGGCAATGGCTTCGACCGAAGGCAACGTCACTGGGATGTTCGCATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) ML. Burts, WA. Williams et al. EsxA and EsxB are secreted by an ESAT-6-like system that is required for the pathogenesis of Staphylococcus aureus infections. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) LM. Okkels & P. Andersen Protein-protein interactions of proteins from the ESAT-6 family of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Regulatory Rv3872	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) ML. Burts, WA. Williams et al. EsxA and EsxB are secreted by an ESAT-6-like system that is required for the pathogenesis of Staphylococcus aureus infections. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) LM. Okkels & P. Andersen Protein-protein interactions of proteins from the ESAT-6 family of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	PhysicalInteraction Rv3872	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	RegulatedBy Rv3414c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2021c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Symbol	ESAT-6	active	jlew	2012-03-07
	Forms homodimer. Forms heterodimer with CFP-10.. Yeast two-hybrid to examine the interactions between ESX-1 proteins J. Teutschbein, G. Schumann et al. A protein linkage map of the ESAT-6 secretion system 1 (ESX-1) of Mycobacterium tuberculosis. Microbiol. Res. 2007