Rv2875 - major secreted immunogenic protein mpt70

Expression: Most Significant Conditions for Rv2875

Protein Domains

Gene Information
Locus	Rv2875
Symbol	mpt70
Gene Name	major secreted immunogenic protein mpt70
Location	3187030 - 3187611 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:582 bp Protein:194 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	13869
Related Genes	CE0063 Mkms_2086 Mkms_2087 Mkms_4153 Mmcs_2040 Mmcs_2041 Mmcs_4077 MSMEG_5196 MT2940 MT2943 Mvan_2258 Mvan_2259 Mvan_4586 Rv2873
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2875
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2875 Transcript 1
MKVKNTIAATSFAAAGLAALAVAVSPPAAAGDLVGPGCAEYAAANPTGPASVQGMSQDPV
AVAASNNPELTTLTAALSGQLNPQVNLVDTLNSGQYTVFAPTNAAFSKLPASTIDELKTN
SSLLTSILTYHVVAGQTSPANVVGTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANA
TVYMIDSVLMPPA*

Genomic Sequence

>Rv2875
ATGAAGGTAAAGAACACAATTGCGGCAACCAGTTTCGCGGCGGCCGGCCTGGCGGCTCTG
GCGGTGGCTGTCTCACCGCCGGCGGCCGCAGGCGATCTGGTGGGCCCGGGCTGCGCGGAA
TACGCGGCAGCCAATCCCACTGGGCCGGCCTCGGTGCAGGGAATGTCGCAGGACCCGGTC
GCGGTGGCGGCCTCGAACAATCCGGAGTTGACAACGCTGACGGCTGCACTGTCGGGCCAG
CTCAATCCGCAAGTAAACCTGGTGGACACCCTCAACAGCGGTCAGTACACGGTGTTCGCA
CCGACCAACGCGGCATTTAGCAAGCTGCCGGCATCCACGATCGACGAGCTCAAGACCAAT
TCGTCACTGCTGACCAGCATCCTGACCTACCACGTAGTGGCCGGCCAAACCAGCCCGGCC
AACGTCGTCGGCACCCGTCAGACCCTCCAGGGCGCCAGCGTGACGGTGACCGGTCAGGGT
AACAGCCTCAAGGTCGGTAACGCCGACGTCGTCTGTGGTGGGGTGTCTACCGCCAACGCG
ACGGTGTACATGATTGACAGCGTGCTAATGCCTCCGGCGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0445c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv0445c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Comparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. Infect. Immun. 1983
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Comparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. Infect. Immun. 1983
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Comparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. Infect. Immun. 1983
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock T-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. Scand. J. Immunol. 1998
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock T-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. Scand. J. Immunol. 1998
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock T-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. Scand. J. Immunol. 1998
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Identification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. Immunology 1994
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Identification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. Immunology 1994
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Identification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. Immunology 1994
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Immunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. Infect. Immun. 1998
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Immunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. Infect. Immun. 1998
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Immunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. Infect. Immun. 1998
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) W. Vosloo, P. Tippoo et al. Characterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. Gene 1997
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) W. Vosloo, P. Tippoo et al. Characterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. Gene 1997
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) W. Vosloo, P. Tippoo et al. Characterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. Gene 1997
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) M. Harboe, HG. Wiker et al. MPB70 and MPB83 as indicators of protein localization in mycobacterial cells. Infect. Immun. 1998
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) M. Harboe, HG. Wiker et al. MPB70 and MPB83 as indicators of protein localization in mycobacterial cells. Infect. Immun. 1998
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) M. Harboe, HG. Wiker et al. MPB70 and MPB83 as indicators of protein localization in mycobacterial cells. Infect. Immun. 1998
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,M. Harboe,S. Nagai MPB70, a unique antigen of Mycobacterium bovis BCG. Am. Rev. Respir. Dis. 1984
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,M. Harboe,S. Nagai MPB70, a unique antigen of Mycobacterium bovis BCG. Am. Rev. Respir. Dis. 1984
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,M. Harboe,S. Nagai MPB70, a unique antigen of Mycobacterium bovis BCG. Am. Rev. Respir. Dis. 1984
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada Complete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. FEMS Microbiol. Lett. 1989
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada Complete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. FEMS Microbiol. Lett. 1989
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada Complete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. FEMS Microbiol. Lett. 1989
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv2872	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	PhysicalInteraction Rv2874	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
Interaction	PhysicalInteraction Rv2873	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) MD. Juárez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001