Rv1793 - esat-6 like protein esxN

Expression: Most Significant Conditions for Rv1793

Protein Domains

Gene Information
Locus	Rv1793
Symbol	esxN
Gene Name	esat-6 like protein esxN
Location	2030694 - 2030978 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:285 bp Protein:95 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11462
Related Genes	MAV_2921 MT1842 MUL_3082
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1793
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1793 Transcript 1
MTINYQFGDVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRN
FQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA*

Genomic Sequence

>Rv1793
ATGACGATTAATTACCAGTTCGGGGACGTCGACGCTCATGGCGCCATGATCCGCGCTCAG
GCGGCGTCGCTTGAGGCGGAGCATCAGGCCATCGTTCGTGATGTGTTGGCCGCGGGTGAC
TTTTGGGGCGGCGCCGGTTCGGTGGCTTGCCAGGAGTTCATTACCCAGTTGGGCCGTAAC
TTCCAGGTGATCTACGAGCAGGCCAACGCCCACGGGCAGAAGGTGCAGGCTGCCGGCAAC
AACATGGCGCAAACCGACAGCGCCGTCGGCTCCAGCTGGGCCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1791	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1792	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1791	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,B. Sidders,M. Withers,SL. Kendall,J. Bacon,SJ. Waddell,J. Hinds,P. Golby,F. Movahedzadeh,RA. Cox,R. Frita,AM. Ten Bokum,L. Wernisch,NG. Stoker Quantification of global transcription patterns in prokaryotes using spotted microarrays. Genome Biol. 2007
Interaction	PhysicalInteraction Rv1792	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,B. Sidders,M. Withers,SL. Kendall,J. Bacon,SJ. Waddell,J. Hinds,P. Golby,F. Movahedzadeh,RA. Cox,R. Frita,AM. Ten Bokum,L. Wernisch,NG. Stoker Quantification of global transcription patterns in prokaryotes using spotted microarrays. Genome Biol. 2007
Interaction	PhysicalInteraction Rv1792	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,B. Sidders,M. Withers,SL. Kendall,J. Bacon,SJ. Waddell,J. Hinds,P. Golby,F. Movahedzadeh,RA. Cox,R. Frita,AM. Ten Bokum,L. Wernisch,NG. Stoker Quantification of global transcription patterns in prokaryotes using spotted microarrays. Genome Biol. 2007
Interaction	PhysicalInteraction Rv1792	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1791	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) authors,B. Sidders,M. Withers,SL. Kendall,J. Bacon,SJ. Waddell,J. Hinds,P. Golby,F. Movahedzadeh,RA. Cox,R. Frita,AM. Ten Bokum,L. Wernisch,NG. Stoker Quantification of global transcription patterns in prokaryotes using spotted microarrays. Genome Biol. 2007