Rv0172 - MCE-family protein mce1D

Expression: Most Significant Conditions for Rv0172

Protein Domains

Gene Information
Locus	Rv0172
Symbol	mce1D
Gene Name	MCE-family protein mce1D
Location	202476 - 204068 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1593 bp Protein:531 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	21367
Related Genes	MAP3607 MAV_5012 Mkms_0130 ML2592 Mmcs_0121 MSMEG_0137 MT0181 MUL_1065 Mvan_0137 nfa50490 nfa56280
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0172
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0172 Transcript 1
MSTIFDIRNLRLPQLSRASVVIGSLVVVLALAAGIVGVRLYQKLTNNTVVAYFTQANALY
VGDKVQIMGLPVGSIDKIEPAGDKMKVTFHYQNKYKVPANASAVILNPTLVASRNIQLEP
PYRGGPVLADNAVIPVERTQVPTEWDELRDSVSHIIDELGPTPEQPKGPFGEVIEAFADG
LAGKGKQINTTLNSLSQALNALNEGRGDFFAVVRSLALFVNALHQDDQQFVALNKNLAEF
TDRLTHSDADLSNAIQQFDSLLAVARPFFAKNREVLTHDVNNLATVTTTLLQPDPLDGLE
TVLHIFPTLAANINQLYHPTHGGVVSLSAFTNFANPMEFICSSIQAGSRLGYQESAELCA
QYLAPVLDAIKFNYFPFGLNVASTASTLPKEIAYSEPRLQPPNGYKDTTVPGIWVPDTPL
SHRNTQPGWVVAPGMQGVQVGPITQGLLTPESLAELMGGPDIAPPSSGLQTPPGPPNAYD
EYPVLPPIGLQAPQVPIPPPPPGPDVIPGPVPPTPAPVGAPLPAEAGGGQ*

Genomic Sequence

>Rv0172
TTGAGCACCATCTTTGATATCCGCAACCTGCGGTTGCCGCAGCTGTCGCGGGCCTCGGTT
GTCATCGGATCGTTGGTGGTGGTGCTGGCGCTGGCCGCCGGAATTGTTGGTGTGCGGCTC
TATCAAAAACTGACGAACAACACGGTGGTCGCCTACTTCACCCAAGCCAATGCGCTGTAT
GTCGGAGACAAGGTCCAGATTATGGGCCTCCCGGTCGGTTCGATCGACAAGATCGAACCA
GCCGGCGACAAAATGAAGGTGACTTTCCACTACCAGAACAAGTACAAGGTGCCTGCCAAT
GCCTCCGCGGTGATCCTCAACCCCACCTTGGTGGCGTCGCGGAACATTCAGTTGGAGCCA
CCCTACAGAGGTGGTCCAGTGCTGGCCGATAATGCGGTGATCCCGGTCGAGCGCACCCAG
GTACCGACGGAGTGGGACGAGCTGCGGGACAGCGTTTCGCATATTATCGACGAGCTCGGC
CCGACACCTGAGCAGCCCAAGGGGCCGTTCGGCGAAGTCATCGAGGCATTCGCCGACGGG
CTGGCCGGCAAGGGTAAGCAAATCAACACCACGCTGAACAGCCTGTCGCAGGCGTTGAAC
GCCTTGAATGAGGGCCGCGGCGACTTCTTCGCGGTGGTACGCAGCCTGGCGCTATTCGTC
AACGCGCTACATCAGGACGACCAACAGTTCGTCGCGTTGAACAAGAACCTTGCGGAGTTC
ACCGACAGGTTGACCCACTCCGATGCGGACCTGTCGAACGCCATCCAGCAATTCGACAGC
TTGCTCGCCGTCGCGCGCCCGTTCTTCGCCAAGAACCGCGAGGTGCTGACGCATGACGTC
AATAATCTCGCGACCGTGACCACCACGTTGCTGCAGCCCGATCCGTTGGATGGGTTGGAG
ACCGTCCTGCACATCTTCCCGACGCTGGCGGCGAACATTAACCAGCTTTACCATCCGACA
CACGGTGGCGTGGTGTCGCTTTCCGCGTTCACGAATTTCGCCAACCCGATGGAGTTCATC
TGCAGCTCGATTCAGGCGGGTAGCCGGCTCGGTTATCAAGAGTCGGCCGAACTCTGTGCG
CAGTATCTGGCGCCAGTCCTCGATGCGATCAAGTTCAACTACTTTCCGTTCGGCCTGAAC
GTGGCCAGCACCGCCTCGACACTGCCTAAAGAGATCGCGTACTCCGAGCCCCGCTTGCAG
CCGCCCAACGGGTACAAGGACACCACGGTGCCCGGCATCTGGGTGCCGGATACGCCGTTG
TCACACCGCAACACGCAGCCCGGTTGGGTGGTGGCACCCGGGATGCAAGGGGTTCAGGTG
GGACCGATCACGCAGGGTTTGCTGACGCCGGAGTCCCTGGCCGAACTCATGGGTGGTCCC
GATATCGCCCCTCCGTCGTCAGGGCTGCAAACCCCGCCCGGACCCCCGAATGCGTACGAC
GAGTACCCCGTGCTGCCGCCGATCGGTTTACAGGCCCCACAGGTGCCGATACCACCGCCG
CCTCCTGGGCCCGACGTAATCCCGGGTCCGGTGCCACCGACGCCGGCACCGGTGGGGGCG
CCGTTGCCCGCTGAGGCAGGAGGGGGTCAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0165c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0178	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0177	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0176	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0175	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0174	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0173	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0171	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0167	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0170	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0169	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0168	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0166	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0178	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0177	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0176	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0175	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0174	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0173	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0171	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0167	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0170	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0169	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0168	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0166	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0178	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0177	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0176	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0175	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0174	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0169	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0166	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0165c	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001