Rv0173 - MCE-family lipoprotein mce1E

Expression: Most Significant Conditions for Rv0173

Protein Domains

Gene Information
Locus	Rv0173
Symbol	lprK
Gene Name	MCE-family lipoprotein mce1E
Location	204065 - 205237 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1173 bp Protein:391 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22739
Related Genes	MAP3608 MAV_5011 Mkms_0131 ML2593 Mmcs_0122 MSMEG_0138 MT0182 MUL_1066 Mvan_0138
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0173
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0173 Transcript 1
MMSVLARMRVMRHRAWQGLVLLVLALLLSSCGWRGISNVAIPGGPGTGPGSYTIYVQMPD
TLAINGNSRVMVADVWVGSIRAIKLKNWVATLTLSLKKDVTLPKNATAKIGQTSLLGSQH
VELAAPPDPSPVPLKDGDTIPLKRSSAYPTTEQTLASIATLLRGGGLVNLEGIQQEINAI
VTGRADQIRAFLGKLDTFTDELNQQRDDITRAIDSTNRLLAYVGGRSEVLNRVLTDLPPL
IKHFADKQELLINASDAVGRLSQSADQYLSAARGDLHQDLQALQCPLKELRRAAPYLVGA
LKLILTQPFDVDTVPQLVRGDYMNLSLTLDLTYSAIDNAFLTGTGFSGALRALEQSFGRD
PETMIPDIRYTPNPNDAPGGPLVERGNRQC*

Genomic Sequence

>Rv0173
ATGATGAGCGTGCTGGCGCGGATGCGGGTGATGCGCCACCGAGCCTGGCAGGGGCTGGTG
TTGCTGGTGCTCGCACTCTTGCTGAGTTCGTGCGGCTGGCGCGGCATCTCCAATGTGGCG
ATCCCCGGCGGCCCGGGCACCGGCCCGGGCTCCTACACCATCTACGTGCAGATGCCGGAC
ACGTTGGCGATCAACGGCAACAGTCGGGTCATGGTGGCCGACGTCTGGGTCGGATCGATC
CGCGCGATCAAGTTGAAGAACTGGGTGGCCACGCTGACGCTGAGCCTGAAGAAGGACGTC
ACGCTACCGAAAAATGCCACCGCCAAGATCGGGCAGACCAGCCTGCTGGGTTCGCAGCAC
GTCGAGCTGGCCGCGCCGCCAGATCCGTCGCCGGTGCCGCTGAAGGATGGTGACACCATC
CCGTTGAAGCGCTCCTCGGCCTATCCCACCACCGAGCAGACGCTGGCCAGCATCGCCACC
TTGTTGCGCGGCGGCGGCCTGGTGAACCTCGAAGGGATTCAGCAAGAGATCAACGCCATC
GTGACGGGGCGGGCGGACCAGATCCGGGCCTTTCTTGGCAAGCTCGACACCTTCACCGAC
GAGCTCAACCAGCAACGCGATGACATTACCCGCGCCATTGATTCCACCAATCGGTTGTTG
GCTTATGTGGGCGGTCGTTCGGAAGTCCTCAATCGGGTGCTCACCGACCTACCGCCATTG
ATCAAGCACTTTGCGGATAAGCAGGAACTGTTGATCAACGCTTCCGATGCGGTAGGCCGG
CTCAGCCAGTCCGCCGACCAGTATCTTTCGGCTGCCCGGGGCGATCTGCACCAGGACCTG
CAGGCGCTGCAATGCCCGCTCAAGGAACTGCGTCGAGCCGCTCCGTATCTGGTGGGTGCG
CTCAAATTGATCCTCACCCAGCCCTTTGACGTCGACACCGTGCCGCAGCTGGTGCGGGGC
GACTACATGAACTTGTCGCTGACGCTGGACCTGACCTACAGCGCCATCGACAATGCGTTC
CTTACCGGGACCGGATTCTCCGGTGCGTTGCGCGCCCTCGAGCAGTCTTTTGGCCGCGAT
CCCGAGACAATGATTCCCGACATCCGGTACACACCGAACCCCAACGATGCGCCGGGCGGC
CCGCTGGTAGAAAGGGGAAATCGCCAGTGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0165c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0169	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0166	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0165c	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0494	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv0494	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006