Rv1990c - transcriptional regulator

Expression: Most Significant Conditions for Rv1990c

Protein Domains

Gene Information
Locus	Rv1990c
Symbol
Gene Name	transcriptional regulator
Location	2233296 - 2233637 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:342 bp Protein:114 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6897
Related Genes	MT2044
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1990c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1990c Transcript 1
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVA
DALAEVLPRDQANVWMFSPNRLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV*

Genomic Sequence

>Rv1990c
ATGGGAGTAAATGTGCTCGCCTCGACCGTGTCGGGTGCGATCGAGCGCTTGGGATTGACC
TACGAGGAAGTCGGTGACATCGTCGATGCCTCGCCGCGTTCCGTGGCGCGATGGACCGCA
GGTCAGGTGGTTCCCCAACGCCTCAACAAGCAACGACTTATCGAGCTGGCCTATGTCGCC
GACGCCCTCGCGGAAGTGCTGCCGCGTGACCAGGCGAACGTGTGGATGTTTTCGCCGAAT
CGGTTACTGGAACACCGCAAGCCTGCCGACCTCGTGCGAGACGGCGAGTACCAACGCGTG
TTGGCGCTCATCGACGCGATGGCGGAGGGAGTGTTCGTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Regulates Rv0440	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003