Rv1102c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1102c

Protein Domains

Gene Information
Locus	Rv1102c
Symbol
Gene Name	conserved hypothetical protein
Location	1230660 - 1230971 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:312 bp Protein:104 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	12868
Related Genes	MT1134
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1102c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1102c Transcript 1
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVV
SCDNTQTIPVCDLGRQIGYLLASQEPALAEAIGNAFDLDWVVA*

Genomic Sequence

>Rv1102c
ATGCGACCTATCCACATCGCACAGCTTGACAAGGCTAGACCCGTCCTGATCCTTACCCGC
GAGGTCGTACGTCCGCACCTCACGAACGTCACCGTCGCCCCGATCACGACAACCGTGCGT
GGGCTAGCCACCGAAGTCCCGGTAGACGCGGTGAACGGGCTGAATCAACCGTCAGTCGTC
AGCTGCGACAACACCCAAACGATCCCGGTGTGTGACCTTGGTCGTCAAATCGGCTACCTG
CTCGCGTCGCAGGAGCCGGCTCTAGCCGAGGCCATCGGCAACGCGTTCGACCTCGATTGG
GTGGTGGCATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1103c	active	priti.priety	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv1103c	active	priti.priety	2012-10-05
	Co-occurrence (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Regulatory Rv1103c	active	priti.priety	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv1103c	active	priti.priety	2012-10-05
	Co-occurrence (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	MazF3	active	jlew	2012-03-07
	Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	mazF-mt6	active	jlew	2012-03-07
	Caused cell growth arrest when induced in Ecoli. mRNA interferase that cleaves at U-rich regions. authors,L. Zhu,Y. Zhang,JS. Teh,J. Zhang,N. Connell,H. Rubin,M. Inouye Characterization of mRNA interferases from Mycobacterium tuberculosis. J. Biol. Chem. 2006
Other	strand:+	active	rslayden	2012-03-05
	MTCI376_17 (102aa), opt: 140, E(): 0.00072, (40.6% identity in 69aa overlap); and Rv1495. TBparse score is 0.924.
Other	stop:1230971	active	rslayden	2012-03-05
	MTCI376_17 (102aa), opt: 140, E(): 0.00072, (40.6% identity in 69aa overlap); and Rv1495. TBparse score is 0.924.
Other	start:1230660	active	rslayden	2012-03-05
	MTCI376_17 (102aa), opt: 140, E(): 0.00072, (40.6% identity in 69aa overlap); and Rv1495. TBparse score is 0.924.
Other	strand:+	active	rslayden	2012-03-05
	MTCY9F9_22 (109 aa), FASTA scores: opt: 158, E(): 3.6e-05, (33.3% identity in 93 aa overlap); Rv0659c
Other	stop:1230971	active	rslayden	2012-03-05
	MTCY9F9_22 (109 aa), FASTA scores: opt: 158, E(): 3.6e-05, (33.3% identity in 93 aa overlap); Rv0659c
Other	start:1230660	active	rslayden	2012-03-05
	MTCY9F9_22 (109 aa), FASTA scores: opt: 158, E(): 3.6e-05, (33.3% identity in 93 aa overlap); Rv0659c
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical protens e.g. Rv1942c
Other	stop:1230971	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical protens e.g. Rv1942c
Other	start:1230660	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical protens e.g. Rv1942c