Rv0445c - alternative RNA polymerase sigma factor sigK

Expression: Most Significant Conditions for Rv0445c

Protein Domains

Gene Information
Locus	Rv0445c
Symbol	sigK
Gene Name	alternative RNA polymerase sigma factor sigK
Location	533833 - 534396 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:564 bp Protein:188 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37112
Related Genes	BL0207 CE0166 CE0168 DIP0090 DIP0091 DIP0092 DIP0095 DIP0097 DIP0099 jk0025 Mkms_4458 Mmcs_4371 MT0461 MUL_1400 Mvan_4927
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0445c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0445c Transcript 1
MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYL
EVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADL
AIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSL
RNCLDVS*

Genomic Sequence

>Rv0445c
ATGACCGGACCGCCACGGCTGAGCAGCGACCTGGACGCCCTGTTGCGCCGGGTCGCTGGT
CACGACCAGGCCGCATTCGCCGAATTCTACGACCACACCAAGTCGCGGGTGTATGGACTG
GTGATGCGGGTGCTGCGTGATACCGGCTACAGCGAAGAAACCACCCAGGAGATCTATCTT
GAGGTGTGGCGGAACGCGTCGGAGTTTGACTCCGCCAAAGGTTCCGCGTTGGCCTGGCTT
TTGACCATGGCCCACCGGCGCGCTGTCGACCGAGTCCGTTGCGAGCAAGCCGGCAACCAG
CGGGAAGTGCGCTATGGTGCGGCCAACGTCGATCCCGCGAGTGACGTCGTCGCCGACCTG
GCGATCGCCGGTGATGAGCGGCGCCGGGTGACCGAGTGCCTCAAGGCGTTGACCGACACG
CAGCGGCAGTGCATCGAACTGGCCTACTACGGCGGGCTGACGTATGTCGAAGTTTCGCGG
CGGTTAGCGGCCAATCTGTCGACCATCAAATCCCGCATGCGCGACGCCCTGCGCAGCCTG
CGCAACTGCCTGGACGTGTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3920c	active	akankshajain.21	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Transcription Rv3889c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	Transcription Rv3889c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv3505	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3504	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2939	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2939	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2935	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2935	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2934	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2934	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2933	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2933	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2932	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2932	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2931	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2931	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2930	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2930	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	PhysicalInteraction Rv2876	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv2876	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	Regulatory Rv2875	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv2875	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	Regulatory Rv2874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv2874	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	Regulatory Rv2873	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv2873	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	Regulatory Rv1535	active	sharanya123	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv1534	active	sharanya123	2012-10-05
	ChIP (Physical interaction) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv1534	active	sharanya123	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv0699	active	sourish10	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Transcription Rv0449c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	Transcription Rv0449c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) D. Charlet, S. Mostowy et al. Reduced expression of antigenic proteins MPB70 and MPB83 in Mycobacterium bovis BCG strains due to a start codon mutation in sigK. Mol. Microbiol. 2005
Interaction	Transcription Rv0449c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	Regulates Rv0448c	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	Regulates Rv0448c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) F. Veyrier, B. Saïd-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
Interaction	Regulates Rv0444c	active	ashwinigbhat	2012-10-05
	Yeast two-hybrid (Physical interaction) B. Saïd-Salim, S. Mostowy et al. Mutations in Mycobacterium tuberculosis Rv0444c, the gene encoding anti-SigK, explain high level expression of MPB70 and MPB83 in Mycobacterium bovis. Mol. Microbiol. 2006
Interaction	Regulates Rv0444c	active	priti.priety	2012-10-05
	Yeast two-hybrid (Physical interaction) B. Saïd-Salim, S. Mostowy et al. Mutations in Mycobacterium tuberculosis Rv0444c, the gene encoding anti-SigK, explain high level expression of MPB70 and MPB83 in Mycobacterium bovis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0444c	active	prabhakarsmail	2012-10-05
	Affinity purification (Physical interaction) B. Saïd-Salim, S. Mostowy et al. Mutations in Mycobacterium tuberculosis Rv0444c, the gene encoding anti-SigK, explain high level expression of MPB70 and MPB83 in Mycobacterium bovis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0444c	active	akankshajain.21	2012-10-05
	Affinity purification (Physical interaction) B. Saïd-Salim, S. Mostowy et al. Mutations in Mycobacterium tuberculosis Rv0444c, the gene encoding anti-SigK, explain high level expression of MPB70 and MPB83 in Mycobacterium bovis. Mol. Microbiol. 2006
Interaction	Regulates Rv2031c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3552	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3551	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3550	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3505	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3504	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3545c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3544c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3543c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3197A	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2939	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2938	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2937	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2936	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2935	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2934	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2933	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2932	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2931	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2930	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1466	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1465	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1464	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1463	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1462	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1461	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1460	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0551c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0440	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0244c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009