Rv0436c - CDP-diacylglycerol-serine o-phosphatidyltransferase pssA

Expression: Most Significant Conditions for Rv0436c

Protein Domains

Gene Information
Locus	Rv0436c
Symbol	pssA
Gene Name	CDP-diacylglycerol-serine o-phosphatidyltransferase pssA
Location	524530 - 525390 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:861 bp Protein:287 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	2981
Related Genes	MAP3929c MAV_4714 Mkms_0606 ML0310 Mmcs_0593 MSMEG_0860 MT0452 MUL_1385 Mvan_0750 nfa52800 SAV1917
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0436c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0436c Transcript 1
MIGKPRGRRGVNLQILPSAMTVLSICAGLTAIKFALEHQPKAAMALIAAAAILDGLDGRV
ARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWPVGWVVVLLYAVCVVLRLARY
NALQDDGTQPAYAHEFFVGMPAPAGAVSMIGLLALKMQFGEGWWTSGWFLSFWVTGTSIL
LVSGIPMKKMHAVSVPPNYAAALLAVLAICAAAAVLAPYLLIWVIIIAYMCHIPFAVRSQ
RWLAQHPEVWDDKPKQRRAVRRASRRAHPYRPSMARLGLRKPGRRL*

Genomic Sequence

>Rv0436c
ATGATCGGAAAGCCCCGCGGCAGGCGAGGGGTAAACCTGCAGATACTGCCCAGCGCGATG
ACGGTGCTGTCCATTTGCGCGGGACTGACCGCAATCAAGTTTGCGCTCGAGCACCAGCCG
AAGGCCGCGATGGCACTGATCGCCGCAGCGGCCATCCTCGACGGGCTCGACGGCCGGGTG
GCCCGCATCCTGGATGCCCAGTCGCGGATGGGCGCAGAGATCGACTCACTGGCCGACGCG
GTGAACTTCGGAGTGACACCCGCGCTGGTGCTTTACGTGTCGATGTTGTCGAAGTGGCCG
GTCGGTTGGGTGGTCGTGCTGCTCTACGCGGTGTGCGTGGTATTACGGCTGGCGCGGTAC
AACGCACTGCAGGACGACGGAACCCAGCCCGCCTACGCGCATGAATTCTTCGTCGGAATG
CCCGCGCCGGCGGGCGCGGTTTCCATGATCGGCCTGCTAGCCCTCAAAATGCAGTTCGGC
GAAGGATGGTGGACCTCGGGCTGGTTCCTCAGCTTTTGGGTGACGGGAACGTCGATACTC
TTGGTCAGCGGGATCCCGATGAAAAAGATGCACGCCGTGTCGGTACCACCCAACTACGCG
GCCGCCCTGCTGGCGGTGCTGGCTATCTGCGCGGCGGCCGCAGTCCTGGCCCCCTACTTG
TTGATCTGGGTGATCATCATCGCCTACATGTGCCATATTCCTTTCGCGGTGCGCAGCCAG
CGCTGGCTTGCCCAACACCCTGAGGTGTGGGACGACAAGCCCAAGCAACGGCGCGCGGTG
CGGCGCGCGAGCCGCCGGGCGCATCCCTACCGGCCGTCGATGGCGCGGCTGGGCCTGCGC
AAGCCGGGTCGACGGCTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:PSSA180 Phosphatidylserine syntase (n-C18:0) - IPI	active	njamshidi	2012-10-05
	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Term	EC:2.7.8.8 CDP-diacylglycerol--serine O-phosphatidyltransferase. - IPI	active	njamshidi	2012-10-05
	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Term	TBRXN:PSSA180 Phosphatidylserine syntase (n-C18:0) - ISS	active	njamshidi	2012-10-05
	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Term	EC:2.7.8.8 CDP-diacylglycerol--serine O-phosphatidyltransferase. - ISS	active	njamshidi	2012-10-05
	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Term	TBRXN:PSSA160 Phosphatidylserine syntase (n-C16:0) - ISS	active	njamshidi	2012-10-05
	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Term	EC:2.7.8.8 CDP-diacylglycerol--serine O-phosphatidyltransferase. - ISS	active	njamshidi	2012-10-05
	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Name	Putative phosphatidylserine synthase	active	mjackson	2012-10-05
	Phospholipid biosynthesis
Term	TBPWY:Phospholipid-Biosynthesis Phospholipid Biosynthesis - NR	active	mjackson	2012-03-05
	Putative phosphatidylserine synthase M. Jackson,DC. Crick,PJ. Brennan Phosphatidylinositol is an essential phospholipid of mycobacteria. J. Biol. Chem. 2000